PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna30401.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 268aa    MW: 28801.4 Da    PI: 6.789
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna30401.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.81.4e-4119117199
                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 
                              +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvh+++Gasnv k+l++l+  +reda++sl+yeAe r+rdPvyG+vg+i+ lq +
  mrna30401.1-v1.0-hybrid  19 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHRVYGASNVAKILNELNAAHREDAVTSLAYEAEFRLRDPVYGCVGLISVLQDR 104
                              7************************************************************************************* PP

                   DUF260  87 leqlkaelallke 99 
                              l++l+++l  +k+
  mrna30401.1-v1.0-hybrid 105 LKKLQTDLYNAKK 117
                              *******988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.47318119IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4119116IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MLNAVEGEAP KMSSNTHSPC AACKFLRRKC TQECVFAPYF PPDQPQKFAN VHRVYGASNV  60
AKILNELNAA HREDAVTSLA YEAEFRLRDP VYGCVGLISV LQDRLKKLQT DLYNAKKDLS  120
TYIGPQALMI PVFHPSPQPE MNGGGAMAVP MLGVPTGPQH GGHAGGQLVI RDQQQQMFEA  180
QQQELVRFNV NGIENGNGFN QMAGGGGGGG GSNGVSLGLG GFDNNAFNNQ MQAAAAAHHH  240
HHQHSVDYQL QAQLMLQPQP KSEGEES*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460237.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_011460238.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_011460239.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_011460240.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_011460241.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ32e-72LBD36_ARATH; LOB domain-containing protein 36
TrEMBLM5WIQ11e-112M5WIQ1_PRUPE; Uncharacterized protein
STRINGPOPTR_0007s11460.16e-77(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-66ASYMMETRIC LEAVES 2-like 1